PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00022.1.g05790.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 414aa    MW: 43187.3 Da    PI: 9.17
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00022.1.g05790.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.3e-39141201262
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                     kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+ss
  Zjn_sc00022.1.g05790.1.am.mkhc 141 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSS 201
                                     7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31137199IPR003851Zinc finger, Dof-type
PfamPF027012.9E-33143199IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.059145199IPR003851Zinc finger, Dof-type
PROSITE patternPS013610147183IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
ERRETERGEG AAIPQRPSTG HSSWLVHLLG TRPLAAPPLE LFVSLASWSY RKPQELLPIE  60
ERDWSPCMHG RGTLESGLVK PMEEMIMAGN PYPNQNRNPA PAAPSAPGPQ RAGGAPAAAP  120
AGASSGAAAG AGTERRARPQ KEKALNCPRC NSTNTKFCYY NNYSLQQPRY FCKTCRRYWT  180
EGGSLRNVPV GGGSRKNKRS SASVSAAAAV ATSAAMVPVG LAAKNPKLMH EGAQDLNLAF  240
PHHNGRGLQP PEFAAFPSLE SSSVGAFSAL DLLRSTGCYV PLQHVQLGMP AEYESAGFAL  300
GELRMPPPPQ SQSMLGFSLD THGTGGVGGA GGYSAGLQDS AAAGRLLFPF EDLKPAVSAG  360
GGVANAGGDQ YKHNKDQGGD GRAASRVTGG HDTPGFWNNS MIGNGSSNGG GGPW
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824101e-131KC582410.1 Sorghum bicolor dof16 protein (dof16) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953427.11e-135PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLK3YTM31e-133K3YTM3_SETIT; Uncharacterized protein
STRINGSi017619m1e-132(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.18e-49Dof family protein